PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00155.1.g00360.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 250aa    MW: 27950.1 Da    PI: 8.7937
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00155.1.g00360.1.am.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.62.4e-192885457
                                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                                      ++t+eq+e+Le++++++++p+ ++r++L +++    +++ +q+kvWFqNrR ++k+
  Zpz_sc00155.1.g00360.1.am.mkhc 28 YVRYTPEQVEALERVYAECPKPTSARRQQLLRECpilaNIEPKQIKVWFQNRRCRDKQ 85
                                    6789***************************************************996 PP

2START71.42.3e-231292492120
                                     HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEE CS
                           START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakae 80 
                                     +aee+++e+v+ka+ ++  Wv+++ +++g+++  +++ s++++g a+ra+g+v  ++++ +e+l d++  W ++++++e
  Zpz_sc00155.1.g00360.1.am.mkhc 129 IAEETLTEFVSKATGTAIDWVQMPGMKPGPDSFGIVSVSHGCRGVAARACGLVNLEPTKILEILKDRP-SWFRDCRSQE 206
                                     789*******************************************************9998888888.********** PP

                                     EEEEECTT..EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TT CS
                           START  81 tlevissg..galqlmvaelqalsplvp.RdfvfvRyirqlga 120
                                     +   +  g  g+++l ++++ a++++v+ Rdf+++Ry+ ++++
  Zpz_sc00155.1.g00360.1.am.mkhc 207 IFTMLPAGngGTIELVYMQMFAPTTVVSaRDFWTLRYTATMED 249
                                     ******9999****************999********988665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-20785IPR009057Homeodomain-like
PROSITE profilePS5007115.5642286IPR001356Homeobox domain
SMARTSM003891.7E-162490IPR001356Homeobox domain
CDDcd000862.12E-162787No hitNo description
SuperFamilySSF466893.21E-172788IPR009057Homeodomain-like
PfamPF000466.9E-172885IPR001356Homeobox domain
CDDcd146868.11E-579118No hitNo description
PROSITE profilePS5084813.111119250IPR002913START domain
Gene3DG3DSA:3.30.530.204.1E-9127250IPR023393START-like domain
SuperFamilySSF559612.33E-17127250No hitNo description
PfamPF018522.8E-20129249IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MAAAVAMRSG SNDGGGGYDK GGMDTGKYVR YTPEQVEALE RVYAECPKPT SARRQQLLRE  60
CPILANIEPK QIKVWFQNRR CRDKQRKESS RLQAVNRKLS AMNKLLLEEN ERLQKQVSQL  120
VHENALLSIA EETLTEFVSK ATGTAIDWVQ MPGMKPGPDS FGIVSVSHGC RGVAARACGL  180
VNLEPTKILE ILKDRPSWFR DCRSQEIFTM LPAGNGGTIE LVYMQMFAPT TVVSARDFWT  240
LRYTATMEDG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632709.11e-155PREDICTED: homeobox-leucine zipper protein HOX10
RefseqXP_015632710.11e-155PREDICTED: homeobox-leucine zipper protein HOX10
SwissprotQ6TAQ61e-157HOX10_ORYSJ; Homeobox-leucine zipper protein HOX10
TrEMBLA0A0E0CTU81e-155A0A0E0CTU8_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0J4U51e-155A0A0E0J4U5_ORYNI; Uncharacterized protein
TrEMBLQ10SW11e-157Q10SW1_ORYSJ; Rolled leaf1, putative, expressed
STRINGLOC_Os03g01890.11e-155(Oryza sativa Japonica Group)
STRINGBGIOSGA011687-PA1e-155(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60690.11e-131HD-ZIP family protein